Recombinant Human RPIA, His-tagged
Cat.No. : | RPIA-31148TH |
Product Overview : | Recombinant full length Human RPIA with N terminal His tag; 331 amino acids with tag, Predicted MWt 35.4 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 311 amino acids |
Description : | The protein encoded by this gene is an enzyme, which catalyzes the reversible conversion between ribose-5-phosphate and ribulose-5-phosphate in the pentose-phosphate pathway. This gene is highly conserved in most organisms. The enzyme plays an essential role in the carbohydrate metabolism. Mutations in this gene cause ribose 5-phosphate isomerase deficiency. A pseudogene is found on chromosome 18. |
Conjugation : | HIS |
Molecular Weight : | 35.400kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 40% Glycerol, 1.17% Sodium chloride, 0.06% EDTA, 0.004% PMSF |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMQRPGPFSTLYGRVLAPLPG RAGGAASGGGGNSWDLPGSHVRLPGRAQSGTRGGAGNTST SCGDSNSICPAPSTMSKAEEAKKLAGRAAVENHVRNNQVL GIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLIL QYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLT QEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPM AYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDW KFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQD GSVNMREKPFC |
Sequence Similarities : | Belongs to the ribose 5-phosphate isomerase family. |
Gene Name | RPIA ribose 5-phosphate isomerase A [ Homo sapiens ] |
Official Symbol | RPIA |
Synonyms | RPIA; ribose 5-phosphate isomerase A; ribose-5-phosphate isomerase; ribose 5 phosphate epimerase; |
Gene ID | 22934 |
mRNA Refseq | NM_144563 |
Protein Refseq | NP_653164 |
MIM | 180430 |
Uniprot ID | P49247 |
Chromosome Location | 2p11.2 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of carbohydrates, organism-specific biosystem; Pentose Phosphate Pathway, organism-specific biosystem; Pentose phosphate pathway, organism-specific biosystem; Pentose phosphate pathway, conserved biosystem; |
Function | isomerase activity; monosaccharide binding; ribose-5-phosphate isomerase activity; |
◆ Recombinant Proteins | ||
RPIA-1571H | Recombinant Human Ribose 5-Phosphate Isomerase A, His-tagged | +Inquiry |
RPIA-14402M | Recombinant Mouse RPIA Protein | +Inquiry |
RPIA-3785R | Recombinant Rhesus Macaque RPIA Protein, His (Fc)-Avi-tagged | +Inquiry |
RPIA-31148TH | Recombinant Human RPIA, His-tagged | +Inquiry |
RPIA-31147TH | Recombinant Human RPIA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPIA-2231HCL | Recombinant Human RPIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPIA Products
Required fields are marked with *
My Review for All RPIA Products
Required fields are marked with *