Recombinant Human RPL12

Cat.No. : RPL12-31150TH
Product Overview : Recombinant full length Human RPL12 with N-terminal proprietary tag. Predicted MW 44.22kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 165 amino acids
Description : Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L11P family of ribosomal proteins. It is located in the cytoplasm. The protein binds directly to the 26S rRNA. This gene is co-transcribed with the U65 snoRNA, which is located in its fourth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Molecular Weight : 44.220kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPK KVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASAL IIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAV ECPAS
Sequence Similarities : Belongs to the ribosomal protein L11P family.
Gene Name RPL12 ribosomal protein L12 [ Homo sapiens ]
Official Symbol RPL12
Synonyms RPL12; ribosomal protein L12; 60S ribosomal protein L12; L12;
Gene ID 6136
mRNA Refseq NM_000976
Protein Refseq NP_000967
MIM 180475
Uniprot ID P30050
Chromosome Location 9q34
Pathway Cap-dependent Translation Initiation, organism-specific biosystem; Cytoplasmic Ribosomal Proteins, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Eukaryotic Translation Elongation, organism-specific biosystem;
Function RNA binding; structural constituent of ribosome;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPL12 Products

Required fields are marked with *

My Review for All RPL12 Products

Required fields are marked with *

0
cart-icon
0
compare icon