Recombinant Human RPL12 protein, GST-tagged
Cat.No. : | RPL12-301606H |
Product Overview : | Recombinant Human RPL12 (1-165 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Ser165 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RPL12 ribosomal protein L12 [ Homo sapiens ] |
Official Symbol | RPL12 |
Synonyms | RPL12; ribosomal protein L12; 60S ribosomal protein L12; L12; |
Gene ID | 6136 |
mRNA Refseq | NM_000976 |
Protein Refseq | NP_000967 |
MIM | 180475 |
UniProt ID | P30050 |
◆ Recombinant Proteins | ||
RPL12-3972R | Recombinant Rhesus monkey RPL12 Protein, His-tagged | +Inquiry |
RPL12-31150TH | Recombinant Human RPL12 | +Inquiry |
RPL12-3789R | Recombinant Rhesus Macaque RPL12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RPL12-14407M | Recombinant Mouse RPL12 Protein | +Inquiry |
RPL12-11566Z | Recombinant Zebrafish RPL12 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL12-2227HCL | Recombinant Human RPL12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPL12 Products
Required fields are marked with *
My Review for All RPL12 Products
Required fields are marked with *