"RSU1" Related Products

Expand

Recombinant Human RSU1

Cat.No.: RSU1-30419TH
Product Overview: Recombinant fragment of Human RSU1 with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: This gene encodes a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the encoded protein was initially isolated based on its ability to inhibit v-Ras transformation. Multiple alternatively spliced transcript variants for this gene have been reported; one of these variants was found only in glioma tumors.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ELTQLKELHIQGNRLTVLPPELGNLDLTGQKQVFKAENNPWVTPIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRKPLAAKNR
Sequence Similarities: Contains 7 LRR (leucine-rich) repeats.
Gene Name: RSU1 Ras suppressor protein 1 [ Homo sapiens ]
Official Symbol: RSU1
Synonyms: RSU1; Ras suppressor protein 1; ras suppressor protein 1; FLJ31034; RSP 1;
Gene ID: 6251
mRNA Refseq: NM_012425
Protein Refseq: NP_036557
MIM: 179555
Uniprot ID: Q15404
Chromosome Location: 10
Pathway: Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-extracellular matrix interactions, organism-specific biosystem; Regulation of cytoskeletal remodeling and cell spreading by IPP complex components, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.