"SAE1" Related Products

Expand
Expand

Recombinant Human SAE1, His-tagged

Cat.No.: SAE1-29262TH
Product Overview: Recombinant fragment, corresponding to amino acids 18-346 of Human SAE1 with N terminal His tag; 329 amino acids, Predicted Mwt 37kDa.
Description: Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expression level increases during S phase and drops in G2 phase (at protein level).
Form: Lyophilised:Reconstitute with 135 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLIL AGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEAS LERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCS RDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHE FVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKV VFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRT DKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPE DFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Sequence Similarities: Belongs to the ubiquitin-activating E1 family.
Gene Name: SAE1 SUMO1 activating enzyme subunit 1 [ Homo sapiens ]
Official Symbol: SAE1
Synonyms: SAE1; SUMO1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; activator Of sumo 1; AOS1; FLJ3091; Sua1;
Gene ID: 10055
mRNA Refseq: NM_001145713
Protein Refseq: NP_001139185
MIM: 613294
Uniprot ID: Q9UBE0
Chromosome Location: 19q13.32
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: ATP-dependent protein binding; contributes_to SUMO activating enzyme activity; enzyme activator activity; ligase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.