"SCGB2A1" Related Products

Recombinant Human SCGB2A1

Cat.No.: SCGB2A1-29236TH
Product Overview: Recombinant full length Human Mammaglobin B with an N-terminal proprietary tag; Predicted MW 36.52 kDa
Protein length: 95 amino acids
Molecular Weight: 36.520kDa
Source: Wheat germ
Tissue specificity: Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
Sequence Similarities: Belongs to the secretoglobin family. Lipophilin subfamily.
Gene Name: SCGB2A1 secretoglobin, family 2A, member 1 [ Homo sapiens ]
Official Symbol: SCGB2A1
Synonyms: SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2 , MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3;
Gene ID: 4246
mRNA Refseq: NM_002407
Protein Refseq: NP_002398
MIM: 604398
Uniprot ID: O75556
Chromosome Location: 11q13
Function: androgen binding; binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.