"SCN2B" Related Products

Expand
Expand
Expand

Recombinant Human SCN2B

Cat.No.: SCN2B-31351TH
Product Overview: Recombinant full length Human Scn2b with N terminal proprietary tag; Predicted MWt 49.76 kDa inclusive of tag.
Description: Sodium channel subunit beta-2 is a protein that in humans is encoded by the SCN2B gene.
Protein length: 215 amino acids
Molecular Weight: 49.760kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain specific.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNV LNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMF LQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPE DEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAV IVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEE EGKTDGEGNPDDGAK
Sequence Similarities: Belongs to the sodium channel auxiliary subunit SCN2B (TC 8.A.17) family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
Gene Name: SCN2B sodium channel, voltage-gated, type II, beta [ Homo sapiens ]
Official Symbol: SCN2B
Synonyms: SCN2B; sodium channel, voltage-gated, type II, beta; sodium channel, voltage gated, type II, beta polypeptide; sodium channel subunit beta-2;
Gene ID: 6327
mRNA Refseq: NM_004588
Protein Refseq: NP_004579
MIM: 601327
Uniprot ID: O60939
Chromosome Location: 11q22-qter
Pathway: Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Interaction between L1 and Ankyrins, organism-specific biosystem; L1CAM interactions, organism-specific biosystem;
Function: voltage-gated ion channel activity; voltage-gated sodium channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.