"SCNM1" Related Products

Recombinant Human SCNM1, His-tagged

Cat.No.: SCNM1-30295TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-226 of Human SCNM1 with N terminal His tag; MWt 26 kDa.
Description: SCNM1 is a zinc finger protein and putative splicing factor. In mice, Scnm1 modifies phenotypic expression of Scn8a (MIM 600702) mutations (Buchner et al.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 69 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDG RFACAICPHRPVLDTLAMLTAHRAGKKHLSSLQLFYGK KQPGKERKQNPKHQNELRREETKAEAPLLTQTRLITQS ALHRAPHYNSCCRRKYRPEAPGPSVSLSPMPPSEVKLQ SGKISREPEPAAGPQAEESATVSAPAPMSPTRRRALDHYL TLRSSGWIPDGRGRWVKDENVEFDSDEEEPPD
Gene Name: SCNM1 sodium channel modifier 1 [ Homo sapiens ]
Official Symbol: SCNM1
Synonyms: SCNM1; sodium channel modifier 1; MGC3180;
Gene ID: 79005
mRNA Refseq: NM_001204856
Protein Refseq: NP_001191785
MIM: 608095
Uniprot ID: Q9BWG6
Chromosome Location: 1q21.3
Function: metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.