Recombinant Human SECTM1

• Cat.No.: SECTM1-31348TH
• Product Overview: Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa

Specification

• Description: This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes.
• Protein length: 220 amino acids
• Molecular Weight: 50.310kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP
• Sequence Similarities: Belongs to the SECTM family.

Gene Information

• Gene Name: SECTM1 secreted and transmembrane 1 [ Homo sapiens ]
• Official Symbol: SECTM1
• Synonyms: SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein
• Gene ID: 6398
• mRNA Refseq: NM_003004
• Protein Refseq: NP_002995
• MIM: 602602
• Uniprot ID: Q8WVN6
• Chromosome Location: 17q25
• Function: cytokine activity; signal transducer activity

Reviews

03/08/2023

I've used a lot of brands, but this one is one of my favorites.

04/15/2022

The storage conditions of SECTM1 are simple, which is convenient for long-term storage and use.

12/07/2020

The expression level and stability are good, and will be repurchased.

Q&As

Does SECTM1 protein interact with other proteins?

The SECTM1 protein may interact with other proteins to fulfill its function. These interactions can involve various types of protein-protein interactions like electrostatic interactions, hydrogen bonding, etc. Understanding these interactions can help unravel the mechanism of action of the SECTM1 protein in cells.

How to design experiments to study the structure and function of SECTM1 protein?

Studying the structure and function of the SECTM1 protein may require the design of a series of experiments, including biochemical and cell biology experiments. For example, its structure can be studied by nuclear magnetic resonance or X-ray crystal diffraction, and its function can be studied by gene knockout or knockdown techniques.

How to evaluate the potential of the SECTM1 protein as a drug target?

Evaluating the potential of the SECTM1 protein as a drug target can involve several aspects, including its expression levels in organisms, its role in biological processes, and its changes in disease. In addition, factors such as ease of drug development for this protein and potential drug side effects need to be considered.

What is the pathological significance of SECTM1 protein?

SECTM1 protein may play an important role in the development and progression of certain diseases. For example, changes in its expression levels may be related to the occurrence and development of tumors. Studying the pathological significance of the SECTM1 protein can help develop therapeutic strategies against this protein.

What are the effects of mutations or modifications in the SECTM1 protein on organisms?

Mutations or modifications in the SECTM1 protein may affect its function and thus affect the organism. The specific effects may vary depending on the type and location of the mutation or modification and may involve various biological processes, such as growth and development, immune response, etc.

How is the expression level of SECTM1 protein regulated?

The expression level of SECTM1 protein may be regulated by a variety of factors, including gene transcription, translation, post-transcriptional modifications, etc. Studying these regulatory mechanisms can help to understand the expression patterns of SECTM1 protein in organisms and its impact on biological processes.