Recombinant Human SECTM1
| Cat.No. : | SECTM1-31348TH |
| Product Overview : | Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 220 amino acids |
| Description : | This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. |
| Molecular Weight : | 50.310kDa inclusive of tags |
| Tissue specificity : | Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP |
| Sequence Similarities : | Belongs to the SECTM family. |
| Gene Name | SECTM1 secreted and transmembrane 1 [ Homo sapiens ] |
| Official Symbol | SECTM1 |
| Synonyms | SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein; |
| Gene ID | 6398 |
| mRNA Refseq | NM_003004 |
| Protein Refseq | NP_002995 |
| MIM | 602602 |
| Uniprot ID | Q8WVN6 |
| Chromosome Location | 17q25 |
| Function | cytokine activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| SECTM1-6258H | Recombinant Human SECTM1 Protein (Gln29-Gly145), C-His tagged | +Inquiry |
| SECTM1-31348TH | Recombinant Human SECTM1 | +Inquiry |
| SECTM1-1273H | Active Recombinant Human SECTM1 protein, hFc&His-tagged | +Inquiry |
| SECTM1-4550H | Recombinant Human SECTM1 protein, hFc-tagged | +Inquiry |
| SECTM1-3967H | Recombinant Human SECTM1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SECTM1 Products
Required fields are marked with *
My Review for All SECTM1 Products
Required fields are marked with *
