Recombinant Human SECTM1
Cat.No. : | SECTM1-31348TH |
Product Overview : | Recombinant full length protein Human SECTM1 containing an N-terminal proprietary tag; Predicted MW 50.31 kDa |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a transmembrane and secreted protein with characteristics of a type 1a transmembrane protein. It is found in a perinuclear Golgi-like pattern and thought to be involved in hematopoietic and/or immune system processes. |
Protein length : | 220 amino acids |
Molecular Weight : | 50.310kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. Found in leukocytes of the myeloid lineage, with the strongest expression observed in granulocytes and no detectable expression in lymphocytes. Expressed in thymic |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKL RAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGAR DSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWP VPAVVTAVFILLVALVMFAWYRCRCSQQRREKKFFLLEPQ MKFAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPS PLGALELLSPQPLFPYAADP |
Sequence Similarities : | Belongs to the SECTM family. |
Gene Name : | SECTM1 secreted and transmembrane 1 [ Homo sapiens ] |
Official Symbol : | SECTM1 |
Synonyms : | SECTM1; secreted and transmembrane 1; secreted and transmembrane protein 1; K12; K12 protein; type 1a transmembrane protein; |
Gene ID : | 6398 |
mRNA Refseq : | NM_003004 |
Protein Refseq : | NP_002995 |
MIM : | 602602 |
Uniprot ID : | Q8WVN6 |
Chromosome Location : | 17q25 |
Function : | cytokine activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
SECTM1-438H | Recombinant Human SECTM1 Protein, His-tagged | +Inquiry |
SECTM1-2571H | Recombinant Human SECTM1, His-tagged | +Inquiry |
SECTM1-1273H | Active Recombinant Human SECTM1 protein, hFc&His-tagged | +Inquiry |
SECTM1-3967H | Recombinant Human SECTM1 protein, His-tagged | +Inquiry |
SECTM1-1947H | Recombinant Human SECTM1 protein, His & GST-tagged | +Inquiry |
◆ Lysates | ||
SECTM1-1946HCL | Recombinant Human SECTM1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket