"SETD3" Related Products

Expand

Recombinant Human SETD3, His-tagged

Cat.No.: SETD3-30077TH
Product Overview: Recombinant fragment, corresponding to amino acids 443-594 of Human SETD3 With N terminal His tag; 152 amino acids, 40 kDa.
Description: SETD3 contains 1 SET domain. The function of the SETD3 protein remains unknown. There are 3 isoforms produced by alternative splicing.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 64 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: TTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSA AVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLP LVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENS IPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE
Gene Name: SETD3 SET domain containing 3 [ Homo sapiens ]
Official Symbol: SETD3
Synonyms: SETD3; SET domain containing 3; C14orf154, chromosome 14 open reading frame 154; histone-lysine N-methyltransferase setd3; FLJ23027;
Gene ID: 84193
mRNA Refseq: NM_032233
Protein Refseq: NP_115609
Uniprot ID: Q86TU7
Chromosome Location: 14q32.2
Function: histone methyltransferase activity (H3-K36 specific); methyltransferase activity; transcription coactivator activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.