"SFN" Related Products

Expand
Expand
Expand

Recombinant Human SFN, His-tagged

Cat.No.: SFN-26015TH
Product Overview: Recombinant Full Length Human 14-3-3 sigma expressed in Saccharomyces cerevisiae; amino acids 1-248; 248 amino acids, 27.7 kDa. This protein is tagged with 26 kDa proprietary tag.
Description: 14-3-3 protein sigma is a protein that in humans is encoded by the SFN gene.
Conjugation: HIS
Tissue specificity: Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEE RNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKG PEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMD ISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLA KTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Sequence Similarities: Belongs to the 14-3-3 family.
Gene Name: SFN stratifin [ Homo sapiens ]
Official Symbol: SFN
Synonyms: SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS;
Gene ID: 2810
mRNA Refseq: NM_006142
Protein Refseq: NP_006133
MIM: 601290
Uniprot ID: P31947
Chromosome Location: 1p36.11
Pathway: Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Cell cycle, organism-specific biosystem;
Function: phosphoprotein binding; protein binding; protein domain specific binding; protein kinase C inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.