Recombinant Full Length Human SFN Protein, C-Flag-tagged

Cat.No. : SFN-942HFL
Product Overview : Recombinant Full Length Human SFN Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mitosis.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 27.6 kDa
AA Sequence : MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSN EEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDK KRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSE
DSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Secreted Protein
Protein Pathways : Cell cycle, p53 signaling pathway
Full Length : Full L.
Gene Name SFN stratifin [ Homo sapiens (human) ]
Official Symbol SFN
Synonyms YWHAS
Gene ID 2810
mRNA Refseq NM_006142.5
Protein Refseq NP_006133.1
MIM 601290
UniProt ID P31947

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFN Products

Required fields are marked with *

My Review for All SFN Products

Required fields are marked with *

0
cart-icon