"SIGIRR" Related Products

Expand
Expand
Expand

Recombinant Human SIGIRR, His-tagged

Cat.No.: SIGIRR-28785TH
Product Overview: Recombinant fragment, corresponding to amino acids 203-410 of Human SIGIRR with N terminal His tag; 208 amino acids, 32kDa.
Description: Single Ig IL-1-related receptor is a protein that in humans is encoded by the SIGIRR gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Mainly expressed in epithelial tissues such as kidney, lung and gut.
Form: Lyophilised:Reconstitute with 121 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: DLLPRAEPSADLLVNLSRCRRLIVVLSDAFLSRAWCSHSF REGLCRLLELTRRPIFITFEGQRRDPAHPALRLLRQHR HLVTLLLWRPGSVTPSSDFWKEVQLALPRKVQYRPVEGDP QTQLQDDKDPMLILRGRVPEGRALDSEVDPDPEGDLGV RGPVFGEPSAPPHTSGVSLGESRSSEVDVSDLGSRNYS ARTDFYCLVSKDDM
Sequence Similarities: Belongs to the interleukin-1 receptor family.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.Contains 1 TIR domain.
Gene Name: SIGIRR single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [ Homo sapiens ]
Official Symbol: SIGIRR
Synonyms: SIGIRR; single immunoglobulin and toll-interleukin 1 receptor (TIR) domain; single Ig IL-1-related receptor; single immunoglobulin domain IL1R1 related; TIR8;
Gene ID: 59307
mRNA Refseq: NM_001135053
Protein Refseq: NP_001128525
MIM: 605478
Uniprot ID: Q6IA17
Chromosome Location: 11p15.5
Pathway: Activated TLR4 signalling, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88:Mal cascade initiated on plasma membrane, organism-specific biosystem; Toll Like Receptor 2 (TLR2) Cascade, organism-specific biosystem;
Function: protein binding; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.