"SMO" Related Products

Expand
Expand
Expand

Recombinant Human SMO

Cat.No.: SMO-31422TH
Product Overview: Recombinant fragment corresponding to amino acids 653-787 of Human Smoothened with an N terminal proprietary tag; Predicted MWt 40.48 kDa inclusive of tag.
Description: The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex.
Protein length: 135 amino acids
Molecular Weight: 40.480kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELH PPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAW TLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH SRTNLMDTELMDADSDF
Sequence Similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
Gene Name: SMO smoothened, frizzled family receptor [ Homo sapiens ]
Official Symbol: SMO
Synonyms: SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11;
Gene ID: 6608
mRNA Refseq: NM_005631
Protein Refseq: NP_005622
MIM: 601500
Uniprot ID: Q99835
Chromosome Location: 7q32.1
Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem;
Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.