Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SMO

Cat.No. : SMO-31422TH
Product Overview : Recombinant fragment corresponding to amino acids 653-787 of Human Smoothened with an N terminal proprietary tag; Predicted MWt 40.48 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex.
Protein length : 135 amino acids
Molecular Weight : 40.480kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELH PPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAW TLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH SRTNLMDTELMDADSDF
Sequence Similarities : Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
Gene Name : SMO smoothened, frizzled family receptor [ Homo sapiens ]
Official Symbol : SMO
Synonyms : SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11;
Gene ID : 6608
mRNA Refseq : NM_005631
Protein Refseq : NP_005622
MIM : 601500
Uniprot ID : Q99835
Chromosome Location : 7q32.1
Pathway : Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem;
Function : G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends