Recombinant Human SMO
Cat.No. : | SMO-31422TH |
Product Overview : | Recombinant fragment corresponding to amino acids 653-787 of Human Smoothened with an N terminal proprietary tag; Predicted MWt 40.48 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 135 amino acids |
Description : | The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. |
Molecular Weight : | 40.480kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAPPPELH PPAPAPSTIPRLPQLPRQKCLVAAGAWGAGDSCRQGAW TLVSNPFCPEPSPPQDPFLPSAPAPVAWAHGRRQGLGPIH SRTNLMDTELMDADSDF |
Sequence Similarities : | Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain. |
Gene Name | SMO smoothened, frizzled family receptor [ Homo sapiens ] |
Official Symbol | SMO |
Synonyms | SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11; |
Gene ID | 6608 |
mRNA Refseq | NM_005631 |
Protein Refseq | NP_005622 |
MIM | 601500 |
Uniprot ID | Q99835 |
Chromosome Location | 7q32.1 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; |
Function | G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding; |
◆ Recombinant Proteins | ||
SMO-5282R | Recombinant Rat SMO Protein, His (Fc)-Avi-tagged | +Inquiry |
SMO-15631M | Recombinant Mouse SMO Protein | +Inquiry |
SMO-31422TH | Recombinant Human SMO | +Inquiry |
Smo-2084M | Recombinant Mouse Smo Protein, His-tagged | +Inquiry |
SMO-6780HF | Recombinant Full Length Human SMO Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMO Products
Required fields are marked with *
My Review for All SMO Products
Required fields are marked with *
0
Inquiry Basket