Recombinant Human SOLH

• Cat.No.: SOLH-27401TH
• Product Overview: Recombinant fragment of Human Calpain 15 with an N terminal proprietary tag; Predicted MWt 35.97 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 94 amino acids
• Description: This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
• Molecular Weight: 35.970kDa inclusive of tags
• Tissue specificity: Widely expressed with higher expression in brain.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
• Sequence Similarities: Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 5 RanBP2-type zinc fingers.

Gene Information

• Gene Name: SOLH small optic lobes homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: SOLH
• Synonyms: SOLH; small optic lobes homolog (Drosophila); small optic lobes (Drosophila) homolog; calpain-15; CAPN15
• Gene ID: 6650
• mRNA Refseq: NM_005632
• Protein Refseq: NP_005623
• MIM: 603267
• Uniprot ID: O75808
• Chromosome Location: 16p13.3
• Function: calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; metal ion binding; peptidase activity; sequence-specific DNA binding transcription factor activity