Cat.No.:	SOLH-27401TH
Product Overview:	Recombinant fragment of Human Calpain 15 with an N terminal proprietary tag; Predicted MWt 35.97 kDa.
Description:	This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
Protein length:	94 amino acids
Molecular Weight:	35.970kDa inclusive of tags
Source:	Wheat germ
Tissue specificity:	Widely expressed with higher expression in brain.
Form:	Liquid
Purity:	Proprietary Purification
Storage buffer:	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:	HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Sequence Similarities:	Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 5 RanBP2-type zinc fingers.

Gene Name:	SOLH small optic lobes homolog (Drosophila) [ Homo sapiens ]
Official Symbol:	SOLH
Synonyms:	SOLH; small optic lobes homolog (Drosophila); small optic lobes (Drosophila) homolog; calpain-15; CAPN15;
Gene ID:	6650
mRNA Refseq:	NM_005632
Protein Refseq:	NP_005623
MIM:	603267
Uniprot ID:	O75808
Chromosome Location:	16p13.3
Function:	calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; metal ion binding; peptidase activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry