"ARID4B" Related Products

Recombinant Human SOLH

Cat.No.: SOLH-27401TH
Product Overview: Recombinant fragment of Human Calpain 15 with an N terminal proprietary tag; Predicted MWt 35.97 kDa.
Description: This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
Protein length: 94 amino acids
Molecular Weight: 35.970kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed with higher expression in brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL
Sequence Similarities: Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 5 RanBP2-type zinc fingers.
Gene Name: SOLH small optic lobes homolog (Drosophila) [ Homo sapiens ]
Official Symbol: SOLH
Synonyms: SOLH; small optic lobes homolog (Drosophila); small optic lobes (Drosophila) homolog; calpain-15; CAPN15;
Gene ID: 6650
mRNA Refseq: NM_005632
Protein Refseq: NP_005623
MIM: 603267
Uniprot ID: O75808
Chromosome Location: 16p13.3
Function: calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; metal ion binding; peptidase activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.