Recombinant Human SOLH
Cat.No. : | SOLH-27401TH |
Product Overview : | Recombinant fragment of Human Calpain 15 with an N terminal proprietary tag; Predicted MWt 35.97 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 94 amino acids |
Description : | This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. |
Molecular Weight : | 35.970kDa inclusive of tags |
Tissue specificity : | Widely expressed with higher expression in brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL |
Sequence Similarities : | Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 5 RanBP2-type zinc fingers. |
Gene Name | SOLH small optic lobes homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | SOLH |
Synonyms | SOLH; small optic lobes homolog (Drosophila); small optic lobes (Drosophila) homolog; calpain-15; CAPN15; |
Gene ID | 6650 |
mRNA Refseq | NM_005632 |
Protein Refseq | NP_005623 |
MIM | 603267 |
Uniprot ID | O75808 |
Chromosome Location | 16p13.3 |
Function | calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; metal ion binding; peptidase activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
ARID4B-431R | Recombinant Rat ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
SOLH-15754M | Recombinant Mouse SOLH Protein | +Inquiry |
ARID4B-3550H | Recombinant Human ARID4B protein, His-tagged | +Inquiry |
ARID4B-4497H | Recombinant Human ARID4B protein, His-tagged | +Inquiry |
Arid4b-3681M | Recombinant Mouse Arid4b, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARID4B Products
Required fields are marked with *
My Review for All ARID4B Products
Required fields are marked with *