Recombinant Human SOLH
| Cat.No. : | SOLH-27401TH |
| Product Overview : | Recombinant fragment of Human Calpain 15 with an N terminal proprietary tag; Predicted MWt 35.97 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 94 amino acids |
| Description : | This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development. |
| Molecular Weight : | 35.970kDa inclusive of tags |
| Tissue specificity : | Widely expressed with higher expression in brain. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | HPKAYLHVQCDCTDSFNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQAFLSDWTASKGTHSPPLTPEVAGLHGPRPL |
| Sequence Similarities : | Belongs to the peptidase C2 family.Contains 1 calpain catalytic domain.Contains 5 RanBP2-type zinc fingers. |
| Gene Name | SOLH small optic lobes homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | SOLH |
| Synonyms | SOLH; small optic lobes homolog (Drosophila); small optic lobes (Drosophila) homolog; calpain-15; CAPN15; |
| Gene ID | 6650 |
| mRNA Refseq | NM_005632 |
| Protein Refseq | NP_005623 |
| MIM | 603267 |
| Uniprot ID | O75808 |
| Chromosome Location | 16p13.3 |
| Function | calcium-dependent cysteine-type endopeptidase activity; cysteine-type peptidase activity; metal ion binding; peptidase activity; sequence-specific DNA binding transcription factor activity; |
| ◆ Recombinant Proteins | ||
| ARID4B-775R | Recombinant Rat ARID4B Protein | +Inquiry |
| ARID4B-3550H | Recombinant Human ARID4B protein, His-tagged | +Inquiry |
| ARID4B-710M | Recombinant Mouse ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ARID4B-3658H | Recombinant Human ARID4B protein, GST-tagged | +Inquiry |
| SOLH-27401TH | Recombinant Human SOLH | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARID4B Products
Required fields are marked with *
My Review for All ARID4B Products
Required fields are marked with *
