Recombinant Human ARID4B protein, GST-tagged

Cat.No. : ARID4B-3658H
Product Overview : Recombinant Human ARID4B protein(406-523 aa), fused to GST tag, was expressed in E. coli.
Availability June 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 406-523 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ARID4B AT rich interactive domain 4B (RBP1-like) [ Homo sapiens ]
Official Symbol ARID4B
Synonyms ARID4B; AT rich interactive domain 4B (RBP1-like); AT rich interactive domain 4B (RBP1 like) , RBP1L1, retinoblastoma binding protein 1 like 1; AT-rich interactive domain-containing protein 4B; BCAA; BRCAA1; SAP180; Rb-binding protein homolog; SIN3A-associated protein 180; sin3-associated polypeptide p180; ARID domain-containing protein 4B; breast cancer-associated antigen 1; 180 kDa Sin3-associated polypeptide; breast carcinoma-associated antigen; breast cancer-associated antigen BRCAA1; retinoblastoma-binding protein 1-like 1; histone deacetylase complex subunit SAP180; RBP1L1; RBBP1L1; MGC163290; DKFZp313M2420;
Gene ID 51742
mRNA Refseq NM_001206794
Protein Refseq NP_001193723
MIM 609696
UniProt ID Q4LE39

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARID4B Products

Required fields are marked with *

My Review for All ARID4B Products

Required fields are marked with *

0
cart-icon