Recombinant Human ARID4B protein, His-tagged
Cat.No. : | ARID4B-3550H |
Product Overview : | Recombinant Human ARID4B protein(406-523 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 406-523 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ARID4B AT rich interactive domain 4B (RBP1-like) [ Homo sapiens ] |
Official Symbol | ARID4B |
Synonyms | ARID4B; AT rich interactive domain 4B (RBP1-like); AT rich interactive domain 4B (RBP1 like) , RBP1L1, retinoblastoma binding protein 1 like 1; AT-rich interactive domain-containing protein 4B; BCAA; BRCAA1; SAP180; Rb-binding protein homolog; SIN3A-associated protein 180; sin3-associated polypeptide p180; ARID domain-containing protein 4B; breast cancer-associated antigen 1; 180 kDa Sin3-associated polypeptide; breast carcinoma-associated antigen; breast cancer-associated antigen BRCAA1; retinoblastoma-binding protein 1-like 1; histone deacetylase complex subunit SAP180; RBP1L1; RBBP1L1; MGC163290; DKFZp313M2420; |
Gene ID | 51742 |
mRNA Refseq | NM_001206794 |
Protein Refseq | NP_001193723 |
MIM | 609696 |
UniProt ID | Q4LE39 |
◆ Recombinant Proteins | ||
ARID4B-709M | Recombinant Mouse ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ARID4B-775R | Recombinant Rat ARID4B Protein | +Inquiry |
ARID4B-431R | Recombinant Rat ARID4B Protein, His (Fc)-Avi-tagged | +Inquiry |
ARID4B-3550H | Recombinant Human ARID4B protein, His-tagged | +Inquiry |
ARID4B-1915M | Recombinant Mouse ARID4B Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARID4B Products
Required fields are marked with *
My Review for All ARID4B Products
Required fields are marked with *
0
Inquiry Basket