Recombinant Human SORT1 protein, GST-tagged
| Cat.No. : | SORT1-29618TH |
| Product Overview : | Recombinant Human SORT1(203 a.a. - 299 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 203-299 a.a. |
| Description : | This gene encodes a member of the VPS10-related sortilin family of proteins. The encoded preproprotein is proteolytically processed by furin to generate the mature receptor. This receptor plays a role in the trafficking of different proteins to either the cell surface, or subcellular compartments such as lysosomes and endosomes. Expression levels of this gene may influence the risk of myocardial infarction in human patients. Alternative splicing results in multiple transcript variants. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.41 kDa |
| AA Sequence : | FAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTI |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | SORT1 sortilin 1 [ Homo sapiens ] |
| Official Symbol | SORT1 |
| Synonyms | SORT1; sortilin 1; sortilin; Gp95; NT3; NTR3; glycoprotein 95; 100 kDa NT receptor; neurotensin receptor 3; LDLCQ6; |
| Gene ID | 6272 |
| mRNA Refseq | NM_002959 |
| Protein Refseq | NP_002950 |
| MIM | 602458 |
| UniProt ID | Q99523 |
| ◆ Recombinant Proteins | ||
| Sort1-3517R | Recombinant Rat Sort1 protein, His-tagged | +Inquiry |
| SORT1-8143H | Recombinant Human SORT1 protein, His & GST-tagged | +Inquiry |
| SORT1-6212H | Recombinant Human SORT1 Protein (Trp50-Asp320), N-GST tagged | +Inquiry |
| SORT1-1527R | Recombinant Rat SORT1 Protein (610-754 aa), His-tagged | +Inquiry |
| Sort1-1374R | Recombinant Rat Sort1 Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SORT1 Products
Required fields are marked with *
My Review for All SORT1 Products
Required fields are marked with *
