"SRD5A2" Related Products

Expand

Recombinant Human SRD5A2

Cat.No.: SRD5A2-31394TH
Product Overview: Recombinant fragment of Human SRD5A2 with an N terminal proprietary tag; Predicted MW 29.81kDa.
Description: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
Protein length: 38 amino acids
Molecular Weight: 29.810kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in high levels in the prostate and many other androgen-sensitive tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
Sequence Similarities: Belongs to the steroid 5-alpha reductase family.
Gene Name: SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
Official Symbol: SRD5A2
Synonyms: SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2;
Gene ID: 6716
mRNA Refseq: NM_000348
Protein Refseq: NP_000339
Uniprot ID: P31213
Chromosome Location: 2p23.1
Pathway: Androgen biosynthesis, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem;
Function: 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.