Recombinant Human SRD5A2

• Cat.No.: SRD5A2-31394TH
• Product Overview: Recombinant fragment of Human SRD5A2 with an N terminal proprietary tag; Predicted MW 29.81kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 38 amino acids
• Description: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
• Molecular Weight: 29.810kDa inclusive of tags
• Tissue specificity: Expressed in high levels in the prostate and many other androgen-sensitive tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
• Sequence Similarities: Belongs to the steroid 5-alpha reductase family.

Gene Information

• Gene Name: SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
• Official Symbol: SRD5A2
• Synonyms: SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2
• Gene ID: 6716
• mRNA Refseq: NM_000348
• Protein Refseq: NP_000339
• Uniprot ID: P31213
• Chromosome Location: 2p23.1
• Pathway: Androgen biosynthesis, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem
• Function: 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity