Recombinant Human SRD5A2
Cat.No. : | SRD5A2-31394TH |
Product Overview : | Recombinant fragment of Human SRD5A2 with an N terminal proprietary tag; Predicted MW 29.81kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 38 amino acids |
Description : | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). |
Molecular Weight : | 29.810kDa inclusive of tags |
Tissue specificity : | Expressed in high levels in the prostate and many other androgen-sensitive tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA |
Sequence Similarities : | Belongs to the steroid 5-alpha reductase family. |
Gene Name | SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ] |
Official Symbol | SRD5A2 |
Synonyms | SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; |
Gene ID | 6716 |
mRNA Refseq | NM_000348 |
Protein Refseq | NP_000339 |
Uniprot ID | P31213 |
Chromosome Location | 2p23.1 |
Pathway | Androgen biosynthesis, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem; |
Function | 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity; |
◆ Recombinant Proteins | ||
SRD5A2-5735R | Recombinant Rat SRD5A2 Protein | +Inquiry |
RFL34267MF | Recombinant Full Length Macaca Fascicularis 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 2(Srd5A2) Protein, His-Tagged | +Inquiry |
SRD5A2-974C | Recombinant Cynomolgus SRD5A2 Protein, His-tagged | +Inquiry |
SRD5A2-2197H | Recombinant Human SRD5A2 protein(29-71aa), His-KSI-tagged | +Inquiry |
SRD5A2-655HF | Recombinant Full Length Human SRD5A2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRD5A2-1480HCL | Recombinant Human SRD5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRD5A2 Products
Required fields are marked with *
My Review for All SRD5A2 Products
Required fields are marked with *
0
Inquiry Basket