Recombinant Human SRD5A2

Cat.No. : SRD5A2-31394TH
Product Overview : Recombinant fragment of Human SRD5A2 with an N terminal proprietary tag; Predicted MW 29.81kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 38 amino acids
Description : This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
Molecular Weight : 29.810kDa inclusive of tags
Tissue specificity : Expressed in high levels in the prostate and many other androgen-sensitive tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPA
Sequence Similarities : Belongs to the steroid 5-alpha reductase family.
Gene Name SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
Official Symbol SRD5A2
Synonyms SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2;
Gene ID 6716
mRNA Refseq NM_000348
Protein Refseq NP_000339
Uniprot ID P31213
Chromosome Location 2p23.1
Pathway Androgen biosynthesis, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem;
Function 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRD5A2 Products

Required fields are marked with *

My Review for All SRD5A2 Products

Required fields are marked with *

0
cart-icon
0
compare icon