"T" Related Products

Expand
Expand

Recombinant Human T

Cat.No.: T-27672TH
Product Overview: Recombinant fragment of Human Brachyury / Bry with N terminal proprietary tag, 36.52kDa inclusive of tag.
Description: The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.
Protein length: 99 amino acids
Molecular Weight: 36.520kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
Sequence Similarities: Contains 1 T-box DNA-binding domain.
Gene Name: T T, brachyury homolog (mouse) [ Homo sapiens ]
Official Symbol: T
Synonyms: T; T, brachyury homolog (mouse); T brachyury (mouse) homolog; brachyury protein;
Gene ID: 6862
mRNA Refseq: NM_003181
Protein Refseq: NP_003172
MIM: 601397
Uniprot ID: O15178
Chromosome Location: 6q27
Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.