"T" Related Products

Expand

Recombinant Human T

Cat.No. : T-27672TH
Product Overview : Recombinant fragment of Human Brachyury / Bry with N terminal proprietary tag, 36.52kDa inclusive of tag.
Description : The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.
Protein length : 99 amino acids
Molecular Weight : 36.520kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
Sequence Similarities : Contains 1 T-box DNA-binding domain.
Gene Name : T T, brachyury homolog (mouse) [ Homo sapiens ]
Official Symbol : T
Synonyms : T; T, brachyury homolog (mouse); T brachyury (mouse) homolog; brachyury protein;
Gene ID : 6862
mRNA Refseq : NM_003181
Protein Refseq : NP_003172
MIM : 601397
Uniprot ID : O15178
Chromosome Location : 6q27
Pathway : Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem;
Function : sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.