"TBX3" Related Products

Expand
Expand

Recombinant Human TBX3

Cat.No.: TBX3-29459TH
Product Overview: Recombinant fragment of Human Tbx3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag.
Description: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
Sequence Similarities: Contains 1 T-box DNA-binding domain.
Gene Name: TBX3 T-box 3 [ Homo sapiens ]
Official Symbol: TBX3
Synonyms: TBX3; T-box 3; ulnar mammary syndrome , UMS; T-box transcription factor TBX3; TBX3 ISO; XHL;
Gene ID: 6926
mRNA Refseq: NM_005996
Protein Refseq: NP_005987
MIM: 601621
Uniprot ID: O15119
Chromosome Location: 12q24.1
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.