Recombinant Human TBX3

• Cat.No.: TBX3-29459TH
• Product Overview: Recombinant fragment of Human Tbx3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Widely expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK
• Sequence Similarities: Contains 1 T-box DNA-binding domain.

Gene Information

• Gene Name: TBX3 T-box 3 [ Homo sapiens ]
• Official Symbol: TBX3
• Synonyms: TBX3; T-box 3; ulnar mammary syndrome , UMS; T-box transcription factor TBX3; TBX3 ISO; XHL
• Gene ID: 6926
• mRNA Refseq: NM_005996
• Protein Refseq: NP_005987
• MIM: 601621
• Uniprot ID: O15119
• Chromosome Location: 12q24.1
• Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity