Recombinant Human TBX3
Cat.No. : | TBX3-29459TH |
Product Overview : | Recombinant fragment of Human Tbx3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This protein is a transcriptional repressor and is thought to play a role in the anterior/posterior axis of the tetrapod forelimb. Mutations in this gene cause ulnar-mammary syndrome, affecting limb, apocrine gland, tooth, hair, and genital development. Alternative splicing of this gene results in three transcript variants encoding different isoforms; however, the full length nature of one variant has not been determined. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glycerol, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KENGTSDESSSEQAAFNCFAQASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAERPRDSGRLDK |
Sequence Similarities : | Contains 1 T-box DNA-binding domain. |
Gene Name | TBX3 T-box 3 [ Homo sapiens ] |
Official Symbol | TBX3 |
Synonyms | TBX3; T-box 3; ulnar mammary syndrome , UMS; T-box transcription factor TBX3; TBX3 ISO; XHL; |
Gene ID | 6926 |
mRNA Refseq | NM_005996 |
Protein Refseq | NP_005987 |
MIM | 601621 |
Uniprot ID | O15119 |
Chromosome Location | 12q24.1 |
Function | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
Tbx3-6322M | Recombinant Mouse Tbx3 Protein, Myc/DDK-tagged | +Inquiry |
TBX3-16532M | Recombinant Mouse TBX3 Protein | +Inquiry |
TBX3-3143H | Recombinant Human TBX3, GST-tagged | +Inquiry |
Tbx3-1587M | Recombinant Mouse Tbx3 protein, His-tagged | +Inquiry |
TBX3-1586H | Recombinant Human TBX3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX3-1199HCL | Recombinant Human TBX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBX3 Products
Required fields are marked with *
My Review for All TBX3 Products
Required fields are marked with *
0
Inquiry Basket