Recombinant Human TBX5

• Cat.No.: TBX5-29460TH
• Product Overview: Recombinant fragment corresponding to amino acids 402-518 of Human TBX5 with an N terminal proprietary tag; Predicted MWt 38.50 kDa inclusiveof tag.

Specification

• Description: This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
• Protein length: 117 amino acids
• Molecular Weight: 38.500kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAG MANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGT LQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS
• Sequence Similarities: Contains 1 T-box DNA-binding domain.

Gene Information

• Gene Name: TBX5 T-box 5 [ Homo sapiens ]
• Official Symbol: TBX5
• Synonyms: TBX5; T-box 5; HOS; T-box transcription factor TBX5
• Gene ID: 6910
• mRNA Refseq: NM_000192
• Protein Refseq: NP_000183
• MIM: 601620
• Uniprot ID: Q99593
• Chromosome Location: 12q24.1
• Pathway: Heart Development, organism-specific biosystem
• Function: DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity