Recombinant Human TBX5
Cat.No. : | TBX5-29460TH |
Product Overview : | Recombinant fragment corresponding to amino acids 402-518 of Human TBX5 with an N terminal proprietary tag; Predicted MWt 38.50 kDa inclusiveof tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 117 amino acids |
Description : | This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene. |
Molecular Weight : | 38.500kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PSMPSYSSCTVTTVQPMDRLPYQHFSAHFTSGPLVPRLAG MANHGSPQLGEGMFQHQTSVAHQPVVRQCGPQTGLQSPGT LQPPEFLYSHGVPRTLSPHQYHSVHGVGMVPEWSDNS |
Sequence Similarities : | Contains 1 T-box DNA-binding domain. |
Gene Name | TBX5 T-box 5 [ Homo sapiens ] |
Official Symbol | TBX5 |
Synonyms | TBX5; T-box 5; HOS; T-box transcription factor TBX5; |
Gene ID | 6910 |
mRNA Refseq | NM_000192 |
Protein Refseq | NP_000183 |
MIM | 601620 |
Uniprot ID | Q99593 |
Chromosome Location | 12q24.1 |
Pathway | Heart Development, organism-specific biosystem; |
Function | DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
TBX5-3145H | Recombinant Human TBX5, GST-tagged | +Inquiry |
TBX5-5747C | Recombinant Chicken TBX5 | +Inquiry |
TBX5-16534M | Recombinant Mouse TBX5 Protein | +Inquiry |
TBX5-5274H | Recombinant Human TBX5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TBX5-29460TH | Recombinant Human TBX5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBX5-1198HCL | Recombinant Human TBX5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBX5 Products
Required fields are marked with *
My Review for All TBX5 Products
Required fields are marked with *