"THOP1" Related Products

Expand
Expand

Recombinant Human THOP1, His-tagged

Cat.No.: THOP1-29998TH
Product Overview: Recombinant fragment, corresponding to amino acids 266-689 of Human Thimet Oligopeptidase with N terminal His tag; 424 amino acids, 55kDa.
Description: Thimet oligopeptidase is an enzyme that in humans is encoded by the THOP1 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 88 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KSRLLGFHTHADYVLEMNMAKTSQTVATFLDELAQKLKPL GEQERAVILELKRAECERRGLPFDGRIRAWDMRYYMNQ VEETRYCVDQNLLKEYFPVQVVTHGLLGIYQELLGLAF HHEEGASAWHEDVRLYTARDAASGEVVGKFYLDLYPREGK YGHAACFGLQPGCLRQDGSRQIAIAAMVANFTKPTADA PSLLQHDEVETYFHEFGHVMHQLCSQAEFAMFSGTHVE RDFVEAPSQMLENWVWEQEPLLRMSRHYRTGSAVPRELLE KLIESRQANTGLFNLRQIVLAKVDQALHTQTDADPAEE YARLCQEILGVPATPGTNMPATFGHLAGGYDAQYYGYL WSEVYSMDMFHTRFKQEGVLNSKVGMDYRSCILRPGGS EDASAMLRRFLGRDPKQDAFLLSKGLQVGGCEPEPQVC
Sequence Similarities: Belongs to the peptidase M3 family.
Gene Name: THOP1 thimet oligopeptidase 1 [ Homo sapiens ]
Official Symbol: THOP1
Synonyms: THOP1; thimet oligopeptidase 1; thimet oligopeptidase;
Gene ID: 7064
mRNA Refseq: NM_003249
Protein Refseq: NP_003240
MIM: 601117
Uniprot ID: P52888
Chromosome Location: 19p13.3
Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Renin-angiotensin system, organism-specific biosystem; Renin-angiotensin system, conserved biosystem;
Function: metal ion binding; metalloendopeptidase activity; peptidase activity; peptide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.