"TP53BP1" Related Products

Recombinant Human TP53BP1, His-tagged

Cat.No.: TP53BP1-26025TH
Product Overview: Recombinant fragment, corresponding to amino acids 1008-1972 of Human 53BP1 with N terminal His tag; 965 amino acids, 137kDa.
Description: Tumor suppressor p53-binding protein 1 also known as p53-binding protein 1 or 53BP1 is a protein that in humans is encoded by the TP53BP1 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 86 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Store at 4°C. Upon reconstitution store at -80oC.
Sequences of amino acids: EKPATGERKNGSTAVAESVASPQKTMSVLSCICEARQENE ARSEDPPTTPIRGNLLHFPSSQGEEEKEKLEGDHTIRQ SQQPMKPISPVKDPVSPASQKMVIQGPSSPQGEAMVTD VLEDQKEGRSTNKENPSKALIERPSQNNIGIQTMECSLRV PETVSAATQTIKNVCEQGTSTVDQNFGKQDATVQTERG SGEKPVSAPGDDTESLHSQGEEEFDMPQPPHGHVLHRH MRTIREVRTLVTRVITDVYYVDGTEVERKVTEETEEPIVECQECETEVSPSQTGGSSGDLGDISSFSSKASSLHRTSS GTSLSAMHSSGSSGKGAGPLRGKTSGTEPADFALPSSR GGPGKLSPRKGVSQTGTPVCEEDGDAGLGIRQGGKAPV TPRGRGRRGRPPSRTTGTRETAVPGPLGIEDISPNLSPDD KSFSRVVPRVPDSTRRTDVGAGALRRSDSPEIPFQAAA GPSDGLDASSPGNSFVGLRVVAKWSSNGYFYSGKITRD VGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVI LSLEQGNRLREQYGLGPYEAVTPLTKAADISLDNLVEG KRKRRSNVSSPATPTASSSSSTTPTRKITESPRASMGV LSGKRKLITSEEERSPAKRGRKSATVKPGAVGAGEFVSPC ESGDNTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATT SDKLASRSKLPDGPTGSSEEEEEFLEIPPFNKQYTESQ LRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYRNYLLPAGYSLEEQ RILDWQPRENPFQNLKVLLVSDQQQNFLELWSEILMTG GAASVKQHHSSAHNKDIALGVFDVVVTDPSCPASVLKC AEALQLPVVSQEWVIQCLIVGERIGFKQHPKYKHDYVSH
Gene Name: TP53BP1 tumor protein p53 binding protein 1 [ Homo sapiens ]
Official Symbol: TP53BP1
Synonyms: TP53BP1; tumor protein p53 binding protein 1; tumor protein p53 binding protein, 1; tumor suppressor p53-binding protein 1; 53BP1; p202;
Gene ID: 7158
mRNA Refseq: NM_001141979
Protein Refseq: NP_001135451
MIM: 605230
Uniprot ID: Q12888
Chromosome Location: 15q15-q21
Pathway: DNA Repair, organism-specific biosystem; Double-Strand Break Repair, organism-specific biosystem; Homologous Recombination Repair, organism-specific biosystem; Homologous recombination repair of replication-independent double-strand breaks, organism-specific biosystem; Recruitment of repair and signaling proteins to double-strand breaks, organism-specific biosystem;
Function: RNA polymerase II activating transcription factor binding; RNA polymerase II transcription cofactor activity; damaged DNA binding; p53 binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.