"TSC2" Related Products

Recombinant Human TSC2, His-tagged

Cat.No.: TSC2-31631TH
Product Overview: Recombinant fragment, corresponding to amino acids 1396-1725 of Human Tuberin Isoform 5 with N terminal His tag, MWt 38kDa.
Description: Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation: HIS
Source: E. coli
Tissue specificity: Liver, brain, heart, lymphocytes, fibroblasts, biliary epithelium, pancreas, skeletal muscle, kidney, lung and placenta.
Form: Lyophilised:Reconstitute with 78 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFVFL QLYHSPFFGDESNKPILLPNESQSFERSVQLLDQIPSY DTHKIAVLYVGEGQSNSELAILSNEHGSYRYTEFLTGL GRLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQ AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIKGQFNFVHVIVTPLDYECNLVSLQCRKDMEGL VDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNP TDIYPSKWIARLRHIKRLRQRICEEAAYSNPSLPLVHP PSHSKAPAQTPAEPTPGYEVGQ
Sequence Similarities: Contains 1 Rap-GAP domain.
Gene Name: TSC2 tuberous sclerosis 2 [ Homo sapiens ]
Official Symbol: TSC2
Synonyms: TSC2; tuberous sclerosis 2; TSC4; tuberin; LAM;
Gene ID: 7249
mRNA Refseq: NM_000548
Protein Refseq: NP_000539
MIM: 191092
Uniprot ID: P49815
Chromosome Location: 16p13.3
Pathway: AKT phosphorylates targets in the cytosol, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; Downstream signaling of activated FGFR, organism-specific biosystem; Energy dependent regulation of mTOR by LKB1-AMPK, organism-specific biosystem;
Function: 14-3-3 protein binding; GTPase activator activity; protein binding; protein heterodimerization activity; protein homodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.