"TYK2" Related Products

Expand

Recombinant Human TYK2

Cat.No. : TYK2-31641TH
Product Overview : Recombinant fragment of Human TYK2 with a proprietary tag: predicted molecular weight 36.63 kDa.
Description : This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.Contains 1 FERM domain.Contains 1 protein kinase domain.Contains 1 SH2 domain.
Gene Name : TYK2 tyrosine kinase 2 [ Homo sapiens ]
Official Symbol : TYK2
Synonyms : TYK2; tyrosine kinase 2; non-receptor tyrosine-protein kinase TYK2; JTK1;
Gene ID : 7297
mRNA Refseq : NM_003331
Protein Refseq : NP_003322
MIM : 176941
Uniprot ID : P29597
Chromosome Location : 19p13.2
Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function : ATP binding; growth hormone receptor binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein tyrosine kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.