Recombinant Human TYK2

Cat.No. : TYK2-31641TH
Product Overview : Recombinant fragment of Human TYK2 with a proprietary tag: predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene encodes a member of the tyrosine kinase and, more specifically, the Janus kinases (JAKs) protein families. This protein associates with the cytoplasmic domain of type I and type II cytokine receptors and promulgate cytokine signals by phosphorylating receptor subunits. It is also component of both the type I and type III interferon signaling pathways. As such, it may play a role in anti-viral immunity. A mutation in this gene has been associated with hyperimmunoglobulin E syndrome (HIES) - a primary immunodeficiency characterized by elevated serum immunoglobulin E.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Observed in all cell lines analyzed. Expressed in a variety of lymphoid and non-lymphoid cell lines.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PVCHLRLLAQAEGEPCYIRDSGVAPTDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHKAVGQPADRPREPLWA
Sequence Similarities : Belongs to the protein kinase superfamily. Tyr protein kinase family. JAK subfamily.Contains 1 FERM domain.Contains 1 protein kinase domain.Contains 1 SH2 domain.
Gene Name TYK2 tyrosine kinase 2 [ Homo sapiens ]
Official Symbol TYK2
Synonyms TYK2; tyrosine kinase 2; non-receptor tyrosine-protein kinase TYK2; JTK1;
Gene ID 7297
mRNA Refseq NM_003331
Protein Refseq NP_003322
MIM 176941
Uniprot ID P29597
Chromosome Location 19p13.2
Pathway Cytokine Signaling in Immune system, organism-specific biosystem; Hepatitis C, organism-specific biosystem; Hepatitis C, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function ATP binding; growth hormone receptor binding; non-membrane spanning protein tyrosine kinase activity; nucleotide binding; protein tyrosine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TYK2 Products

Required fields are marked with *

My Review for All TYK2 Products

Required fields are marked with *

0
cart-icon