"UGT1A7" Related Products

Recombinant Human UGT1A7

Cat.No.: UGT1A7-31664TH
Product Overview: Recombinant full length UGT1A7 protein (Human)
Description: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5 exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.
Tissue specificity: Liver and gastric tissue.
Biological activity: Vial Content: 5 mg protein.concentration 2-20 mg/mL protein
Form: Liquid
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 100mM Potassium phosphate, 1mM DTT, 0.1mM EDTA, pH 7.4
Storage: Aliquot and store at -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFT MQSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTS YTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLF FSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKY FSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDA MTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVT AYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQG KPVPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIA DALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGH PMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKR METKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRL SSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTW YQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGR VKKAHKSKTH
Sequence Similarities: Belongs to the UDP-glycosyltransferase family.
Gene Name: UGT1A7 UDP glucuronosyltransferase 1 family, polypeptide A7 [ Homo sapiens ]
Official Symbol: UGT1A7
Synonyms: UGT1A7; UDP glucuronosyltransferase 1 family, polypeptide A7; UDP glycosyltransferase 1 family, polypeptide A6; UDP-glucuronosyltransferase 1-7; UGT1G;
Gene ID: 54577
mRNA Refseq: NM_019077
Protein Refseq: NP_061950
MIM: 606432
Uniprot ID: Q9HAW7
Chromosome Location: 2q37
Pathway: Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Ascorbate biosynthesis, animals, glucose-1P => ascorbate, organism-specific biosystem; Ascorbate biosynthesis, animals, glucose-1P =>
Function: drug binding; enzyme binding; enzyme inhibitor activity; glucuronosyltransferase activity; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.