Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human VPS33B, His-tagged

Cat.No. : VPS33B-31739TH
Product Overview : Recombinant fragment, corresponding to amino acids 406-562 of Human VPS33B with N terminal His tag; MWt 18kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. This gene is a member of the Sec-1 domain family, and encodes the human ortholog of rat Vps33b which is homologous to the yeast class C Vps33 protein. The mammalian class C Vps proteins are predominantly associated with late endosomes/lysosomes, and like their yeast counterparts, may mediate vesicle trafficking steps in the endosome/lysosome pathway.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 95 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTE QAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSN FRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLS CRIIEQVLERRSWQGLDEVVRLLNCSDFAFTDMTKEDK ASS
Gene Name : VPS33B vacuolar protein sorting 33 homolog B (yeast) [ Homo sapiens ]
Official Symbol : VPS33B
Synonyms : VPS33B; vacuolar protein sorting 33 homolog B (yeast); vacuolar protein sorting 33B (yeast homolog); vacuolar protein sorting-associated protein 33B; FLJ14848;
Gene ID : 26276
mRNA Refseq : NM_018668
Protein Refseq : NP_061138
MIM : 608552
Uniprot ID : Q9H267
Chromosome Location : 15q26.1
Function : protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All VPS33B Products

Required fields are marked with *

My Review for All VPS33B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends