"WDR5" Related Products

Expand

Recombinant Human WDR5, His-tagged

Cat.No.: WDR5-31543TH
Product Overview: Recombinant full length Human WDR5 with an N terminal His tag; single, non-glycosylated polypeptide chain; 354 amino acids including tag, MWt 38.8 kDa.
Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.
Protein length: 334 amino acids
Conjugation: HIS
Molecular Weight: 38.800kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:10% Glycerol, 0.03% DTT, 0.58% Sodium chloride, 0.24% Tris
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMATEEKKPETEAARAQPTPS SSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSN LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV KFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKY CIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH TDVVISTACHPTENIIASAALENDKTIKLWKSDC
Sequence Similarities: Belongs to the WD repeat WDR5/wds family.Contains 7 WD repeats.
Gene Name: WDR5 WD repeat domain 5 [ Homo sapiens ]
Official Symbol: WDR5
Synonyms: WDR5; WD repeat domain 5; WD repeat-containing protein 5; SWD3; Set1c WD40 repeat protein; homolog (S. cerevisiae);
Gene ID: 11091
mRNA Refseq: NM_017588
Protein Refseq: NP_060058
MIM: 609012
Uniprot ID: P61964
Chromosome Location: 9q34
Pathway: Circadian rhythm pathway, organism-specific biosystem;
Function: contributes_to histone methyltransferase activity (H3-K4 specific); protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.