"NOS2" Related Products

Expand
Expand
Expand

Recombinant Human NOS2, His-Flag-tagged

Cat.No. : NOS2-611H
Product Overview : Recombinant Human NOS2(a.a. 2 – 1153) fussed with His-Flag tag at N-terminal was expressed in a baculovirus infected Sf9 cell expression system.
Description : Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.
Source : Insect cell
Species : Human
Tag : His-Flag
Form : 40 mM Tris-HCl, pH 8.0, 110 mM NaCl, 2.2 mM KCl, 80 ng/µl FLAG peptide, and 20% glycerol.
Molecular Mass : MW= 133 kDa
AA Sequence : MHHHHHHDYKDDDDKACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPT PPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRCIGRIQWSN LQVFDARSCSTAREMFEHICRHVRYSTNNGNIRSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDP ANVEFTQLCIDLGWKPKYGRFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANM LLEVGGLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINIAVLHSFQKQ NVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEMLNYVLSPFYYYQVEAWKTHVWQ DEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVTILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYR LSCLEEERLLLVVTSTFGNGDCPGNGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGA SQLTPMGEGDELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKAL SSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDGPTP HQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQLLLQKLAQVATEEPERQRLEALCQPSEYSKW KFTNSPTFLEVLEEFPSLRVSAGFLLSQLPILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCS TWLNSLKPQDPVPCFVRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRR PDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVA HTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQPSSLEMSAL
Purity : ≥95%
Applications : Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.
Stability : >6 months at –80 centigrade
Concentration : 0.15 mg/ml
Warning : Avoid freeze/thaw cycles.
Gene Name : NOS2 nitric oxide synthase 2, inducible [ Homo sapiens ]
Official Symbol : NOS2
Synonyms : NOS; INOS; NOS2A; HEP-NOS; nitric oxide synthase, inducible; NOS type II; NOS, type II; hepatocyte NOS; inducible NO synthase; inducible NOS; nitric oxide synthase 2A (inducible, hepatocytes); nitric oxide synthase, macrophage; peptidyl-cysteine S-nitrosylase NOS2
Gene ID : 4843
mRNA Refseq : NM_000625
Protein Refseq : NP_000616
MIM : 163730
UniProt ID : P35228
Chromosome Location : 17q11.2
Pathway : AGE/RAGE pathway, organism-specific biosystem; ATF-2 transcription factor network, organism-specific biosystem; Calcium signaling pathway, conserved biosystem
Function : FMN binding; NADPH-hemoprotein reductase activity; iron ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.