GMP Recombinant Human CTLA4 Protein

• Cat.No.: CTLA4-155HG
• Product Overview: Recombinant Human CTLA4 (Lys36-Asp161) with a Fc tag at the C-terminus was produced in HEK293 cell in an animal component free process under cGMP guidelines.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc
• Protein Length: 36-161 a.a.
• Description: Cytotoxic Tlymphocyte 4(CTLA-4,CD152), is a type I transmembrane T cell inhibitory molecule that is a member of the Ig superfamily. Human or mouse CTLA4 cDNA encodes 223 amino acids (aa) including a 35 aa signal sequence, a 126 aa extracellular domain (ECD) with one Ig-like V-type domain, a 21 aa transmembrane (TM) sequence, and a 41 aa cytoplasmic sequence.It is widely expressed with highest levels in lymphoid tissues. CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.
• Form: Lyophilized.
• AA Sequence: KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDQEPK SSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Residual Host Cell DNA Content: <10pg/mg
• Residual Host Cell Protein Content: <1ug/mg
• Endotoxin: <0.1EU/ug
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Usage: Recommemnd working concentration: 10-100ug/ml
• Storage: Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration >100μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: CTLA4 cytotoxic T-lymphocyte-associated protein 4 [ Homo sapiens ]
• Official Symbol: CTLA4
• Synonyms: CTLA4; cytotoxic T-lymphocyte-associated protein 4; CD; CD28; CD152; GSE; ICOS; CD152 isoform; celiac disease 3; cytotoxic T-lymphocyte antigen 4; GRD4; CTLA-4; IDDM12; CELIAC3
• Gene ID: 1493
• mRNA Refseq: NM_001037631
• Protein Refseq: NP_001032720
• UniProt ID: P16410