Active Recombinant Mouse Ctla4 Protein, hIgG/His-tagged

• Cat.No.: Ctla4-06M
• Product Overview: Recombinant mouse Ctla-4 (38-161aa), fused to hIgG-His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: Fc&His
• Protein Length: 38-161 a.a.
• Description: This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Form: Liquid
• Bio-activity: The activity is determined by the IL-2 ELISA in a using stimulated Jurkat human acute T cell leukemia cells with Human B7-1/CD80. The ED50 range ≤ 150 ng/mL.
• Molecular Mass: 40.6 kDa (363aa)
• AA Sequence: IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ]
• Official Symbol: Ctla4
• Synonyms: Ctla4; cytotoxic T-lymphocyte-associated protein 4; Cd152; Ly-56; Ctla-4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4
• Gene ID: 12477
• mRNA Refseq: NM_009843
• Protein Refseq: NP_033973
• UniProt ID: P09793