Active Recombinant Mouse Ctla4 Protein, hIgG/His-tagged

Cat.No. : Ctla4-06M
Product Overview : Recombinant mouse Ctla-4 (38-161aa), fused to hIgG-His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : Fc&His
Protein Length : 38-161 a.a.
Description : This gene is a member of the immunoglobulin superfamily, and encodes a protein that functions as a negative regulator of T-cell responses. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Form : Liquid
Bio-activity : The activity is determined by the IL-2 ELISA in a using stimulated Jurkat human acute T cell leukemia cells with Human B7-1/CD80. The ED50 range ≤ 150 ng/mL.
Molecular Mass : 40.6 kDa (363aa)
AA Sequence : IQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Ctla4 cytotoxic T-lymphocyte-associated protein 4 [ Mus musculus (house mouse) ]
Official Symbol Ctla4
Synonyms Ctla4; cytotoxic T-lymphocyte-associated protein 4; Cd152; Ly-56; Ctla-4; cytotoxic T-lymphocyte protein 4; CD152 antigen; cytotoxic T-lymphocyte-associated antigen 4
Gene ID 12477
mRNA Refseq NM_009843
Protein Refseq NP_033973
UniProt ID P09793

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ctla4 Products

Required fields are marked with *

My Review for All Ctla4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon