GMP Recombinant Human FGF7 protein
Cat.No. : | FGF7-142HG |
Product Overview : | Recombinant Human FGF7 protein was expressed in Escherichia coli. This product is produced under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 163 |
Description : | Human KGF-1 also known as Fibroblast growth factor 7 (FGF-7), is encoded by the FGF7 gene. KGF-1 only binds to the b splice form of the tyrosine kinase receptor, FGFR2b/KGFR. Affinity between KGF-1 and its receptor can be increased by heparin or heparan sulfate proteoglycan. FGF-10, also called keratinocyte growth factor 2 (KGF-2), shares 51 % amino acid sequence identity and similar function to KGF-1, but uses an additional receptor, FGFR2c. KGF-1 plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF-1 actives on keratinocytes, and exhibits mitogenic activity for epidermal cells, but essentially no activity for fibroblasts. KGF-1 has species crossactive, human KGF-1 shares 96 % amino acid sequence identity with murine, and 92 % with rat. |
Form : | Lyophilized from a 0.2μm filtered solution in 20mM PB, pH 7.4, 500 mM NaCl, 0.02 % Tween-20. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 18.9 kDa, a single, non-glycosylated polypeptide chain containing 163 amino acids. |
AA Sequence : | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Endotoxin : | Less than 0.01 EU/µg of rHuKGF-1/FGF-7 GMP as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 centigrade as supplied.1 month, 2 to 8 centigrade under sterile conditions after reconstitution.3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | FGF7 |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
◆ Recombinant Proteins | ||
FGF7-18H | Active Recombinant Human FGF7 Protein, Pre-aliquoted | +Inquiry |
Fgf7-191R | Recombinant Rat Fgf7 protein, His/S-tagged | +Inquiry |
FGF7-1523R | Recombinant Rhesus Macaque FGF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF7-5856M | Recombinant Mouse FGF7 Protein | +Inquiry |
FGF7-3019H | Recombinant Human FGF7 Protein (Cys32-Thr194), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *
0
Inquiry Basket