GMP Recombinant Human IL15 protein
Cat.No. : | IL15-01HG |
Product Overview : | GMP Recombinant Human IL15 protein(P40933)(49-162 aa) was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 49-162 aa |
Form : | PBS, 5% mannitol and 0.01% Tween 80, pH7.4. |
Bio-activity : | Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml, corresponding to a specificBioactivity of ≥ 2 x 10^6 units/mg. |
Molecular Mass : | 12.7 kDa |
AASequence : | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Endotoxin : | ≤10 EU/mg by the LAL method |
Purity : | ≥95%, by SDS-PAGE |
Storage : | 36 months at 2°C to 8°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended to redissolve in sterile deionized water. |
Gene Name | IL15 interleukin 15 [ Homo sapiens ] |
Official Symbol | IL15 |
Synonyms | IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15; |
Gene ID | 3600 |
mRNA Refseq | NM_000585 |
Protein Refseq | NP_000576 |
MIM | 600554 |
UniProt ID | P40933 |
◆ Recombinant Proteins | ||
IL15-004H | Active Recombinant Human IL15 Protein, His-tagged | +Inquiry |
IL15-147P | Recombinant Active Pig IL15 Protein, His-tagged(N-ter) | +Inquiry |
IL15-25H | Active Recombinant Human IL15 | +Inquiry |
IL15-0178M | Active Recombinant Mouse IL15 protein, Fc-tagged | +Inquiry |
Il15-146M | Recombinant Active Mouse IL15 Protein, His-tagged(N-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *