GMP Recombinant Human IL15 protein
| Cat.No. : | IL15-01HG |
| Product Overview : | GMP Recombinant Human IL15 protein(P40933)(49-162 aa) was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Protein Length : | 49-162 aa |
| Form : | PBS, 5% mannitol and 0.01% Tween 80, pH7.4. |
| Bio-activity : | Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml, corresponding to a specificBioactivity of ≥ 2 x 10^6 units/mg. |
| Molecular Mass : | 12.7 kDa |
| AASequence : | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Endotoxin : | ≤10 EU/mg by the LAL method |
| Purity : | ≥95%, by SDS-PAGE |
| Storage : | 36 months at 2°C to 8°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended to redissolve in sterile deionized water. |
| Gene Name | IL15 interleukin 15 [ Homo sapiens ] |
| Official Symbol | IL15 |
| Synonyms | IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15; |
| Gene ID | 3600 |
| mRNA Refseq | NM_000585 |
| Protein Refseq | NP_000576 |
| MIM | 600554 |
| UniProt ID | P40933 |
| ◆ Recombinant Proteins | ||
| Il15-231R | Recombinant Rat Interleukin 15 | +Inquiry |
| IL15-370I | Active Recombinant Human IL15 Protein (121 aa), His-tagged | +Inquiry |
| Il15-092M | Recombinant Mouse Il15 Protein, MYC/DDK-tagged | +Inquiry |
| IL15-1006C | Recombinant Chicken IL15 Protein, His-tagged | +Inquiry |
| IL15-6361H | Recombinant Human IL15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *
