GMP Recombinant Human IL15 protein

Cat.No. : IL15-01HG
Product Overview : GMP Recombinant Human IL15 protein(P40933)(49-162 aa) was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Protein Length : 49-162 aa
Form : PBS, 5% mannitol and 0.01% Tween 80, pH7.4.
Bio-activity : Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml, corresponding to a specificBioactivity of ≥ 2 x 10^6 units/mg.
Molecular Mass : 12.7 kDa
AASequence : NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin : ≤10 EU/mg by the LAL method
Purity : ≥95%, by SDS-PAGE
Storage : 36 months at 2°C to 8°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended to redissolve in sterile deionized water.
Gene Name IL15 interleukin 15 [ Homo sapiens ]
Official Symbol IL15
Synonyms IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15;
Gene ID 3600
mRNA Refseq NM_000585
Protein Refseq NP_000576
MIM 600554
UniProt ID P40933

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0
cart-icon