GMP Recombinant Human IL15 protein

• Cat.No.: IL15-01HG
• Product Overview: GMP Recombinant Human IL15 protein(P40933)(49-162 aa) was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Tag: Non
• Protein Length: 49-162 aa
• Form: PBS, 5% mannitol and 0.01% Tween 80, pH7.4.
• Bio-activity: Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is ≤0.5ng/ml, corresponding to a specificBioactivity of ≥ 2 x 10^6 units/mg.
• Molecular Mass: 12.7 kDa
• AASequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Endotoxin: ≤10 EU/mg by the LAL method
• Purity: ≥95%, by SDS-PAGE
• Storage: 36 months at 2°C to 8°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended to redissolve in sterile deionized water.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens ]
• Official Symbol: IL15
• Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15
• Gene ID: 3600
• mRNA Refseq: NM_000585
• Protein Refseq: NP_000576
• MIM: 600554
• UniProt ID: P40933