Active GMP Recombinant Human TGFB1 Protein

• Cat.No.: TGFB1-159HG
• Product Overview: Recombinant Human TGFB1 (Ala279-Ser390) was produced in HEK293 cell with an animal component free process under cGMP guidelines.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Protein Length: 279-390 a.a.
• Description: Transforming Growth Factor β-1 (TGFβ-1) is a secreted protein which belongs to the TGF-β family. TGFβ-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGFβ-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGFβ-1 peptide. TGFβ-1 may also form heterodimers with other TGFβ family members. It has been found that TGFβ-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease.
• Form: Lyophilized.
• Bio-activity: >2.0x10^7 U/mg
• AA Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Residual Host Cell DNA Content: <10pg/mg
• Residual Host Cell Protein Content: <1ug/mg
• Endotoxin: <0.1EU/ug
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration >100μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: TGFB1 transforming growth factor, beta 1 [ Homo sapiens ]
• Official Symbol: TGFB1
• Synonyms: TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; LAP; DPD1; TGFB
• Gene ID: 7040
• mRNA Refseq: NM_000660
• Protein Refseq: NP_000651
• MIM: 190180
• UniProt ID: P01137