Expand
Expand
| Cat.No.: | TGFB1-159HG |
| Product Overview: | Recombinant Human TGFB1 (Ala279-Ser390) was produced in HEK293 cell with an animal component free process under cGMP guidelines. |
| Description: | Transforming Growth Factor β-1 (TGFβ-1) is a secreted protein which belongs to the TGF-β family. TGFβ-1 is abundantly expressed in bone, articular cartilage and chondrocytes and is increased in osteoarthritis (OA). TGFβ-1 performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The precursor is cleaved into a latency-associated peptide (LAP) and a mature TGFβ-1 peptide. TGFβ-1 may also form heterodimers with other TGFβ family members. It has been found that TGFβ-1 is frequently upregulated in tumor cells. Mutations in this gene results in Camurati-Engelmann disease. |
| Source: | HEK293 cell |
| Species: | Human |
| Form: | Lyophilized. |
| Bio-activity: | >2.0x10^7 U/mg |
| AA Sequence: | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Residual Host Cell DNA Content: | <10pg/mg |
| Residual Host Cell Protein Content: | <1ug/mg |
| Endotoxin: | <0.1EU/ug |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage: | Lyophilized and reconstituted protein should be stored at -80 centigrade. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Reconstitution: | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration >100μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Quality Statement: | Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing. |
| Shipping: | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name: | TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
| Official Symbol: | TGFB1 |
| Synonyms: | TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; LAP; DPD1; TGFB |
| Gene ID: | 7040 |
| mRNA Refseq: | NM_000660 |
| Protein Refseq: | NP_000651 |
| MIM: | 190180 |
| UniProt ID: | P01137 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All TGFB1 Products
Download Datasheet