GMP Recombinant Mouse Cdnf Protein, His-Tagged

• Cat.No.: Cdnf-01M
• Product Overview: GMP Recombinant Mouse Cdnf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Predicted to enable growth factor activity. Predicted to be involved in dopaminergic neuron differentiation and neuron projection development. Predicted to be located in extracellular region. Predicted to be active in endoplasmic reticulum and extracellular space. Is expressed in several structures, including brain; genitourinary system; hemolymphoid system gland; salivary gland; and skeletal muscle tissue. Orthologous to human CDNF (cerebral dopamine neurotrophic factor).
• Form: Lyophilized
• AA Sequence: MQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: Cdnf cerebral dopamine neurotrophic factor [ Mus musculus (house mouse) ]
• Official Symbol: Cdnf
• Synonyms: Armetl1; 9330140G23
• Gene ID: 227526
• mRNA Refseq: NM_177647.4
• Protein Refseq: NP_808315.1
• UniProt ID: Q8CC36