GMP Recombinant Mouse Cdnf Protein, His-Tagged

Cat.No. : Cdnf-01M
Product Overview : GMP Recombinant Mouse Cdnf Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Predicted to enable growth factor activity. Predicted to be involved in dopaminergic neuron differentiation and neuron projection development. Predicted to be located in extracellular region. Predicted to be active in endoplasmic reticulum and extracellular space. Is expressed in several structures, including brain; genitourinary system; hemolymphoid system gland; salivary gland; and skeletal muscle tissue. Orthologous to human CDNF (cerebral dopamine neurotrophic factor).
Form : Lyophilized
AA Sequence : MQGLEAGVGPRADCEVCKEFLDRFYNSLLSRGIDFSADTIEKELLNFCSDAKGKENRLCYYLGATTDAATKILGEVTRPMSVHIPAVKICEKLKKMDSQICELKYGKKLDLASVDLWKMRVAELKQILQRWGEECRACAEKSDYVNLIRELAPKYVEIYPQTEL with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name Cdnf cerebral dopamine neurotrophic factor [ Mus musculus (house mouse) ]
Official Symbol Cdnf
Synonyms Armetl1; 9330140G23
Gene ID 227526
mRNA Refseq NM_177647.4
Protein Refseq NP_808315.1
UniProt ID Q8CC36

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cdnf Products

Required fields are marked with *

My Review for All Cdnf Products

Required fields are marked with *

0

Inquiry Basket

cartIcon