GMP Recombinant Porcine CXCL13 Protein, His-Tagged

• Cat.No.: CXCL13-01P
• Product Overview: GMP Recombinant Porcine CXCL13 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.

Specification

• Species: Porcine
• Source: E.coli
• Tag: His
• Description: CXCL13, also known as BCA-1 (B Cell-Attracting chemokine 1) or BLC, , is a recently identified new CXC chemokines. This chemokine is expressed in the stomach, spleen, liver, appendix and lymph nodes. CXCL13 can only elicit its activities through CXCR5receptor. BCA-1/BLC is a potent chemoattractant for B lymphocytes, and induces weak chemotactic response in T cells and macrophages. It should be noticed that CXCL13 shows no activity on neutrophils and monocytes.
• Form: Lyophilized
• AA Sequence: VLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Notes: Please use within one month after protein reconstitution.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Gene Information

• Gene Name: CXCL13 C-X-C motif chemokine ligand 13 [ Sus scrofa (pig) ]
• Official Symbol: CXCL13
• Gene ID: 100524265
• mRNA Refseq: XM_003129101.3
• Protein Refseq: XP_003129149.1
• UniProt ID: A0A287A706