Recombinant Rhesus CXCL13 protein
Cat.No. : | CXCL13-1322R |
Product Overview : | Recombinant Rhesus CXCL13 protein was expressed in Escherichia coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhesus macaque |
Source : | E.coli |
Tag : | Non |
Protein Length : | 87 |
Description : | B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20mM Tris-HCl, pH 8.0, 300mM NaCl. |
Molecular Mass : | Approximately 10.3 kDa, a single non-glycosylated polypeptide chain containing 87 amino acids. |
AA Sequence : | VLEVYYTHLRCRCVQESSVFIPRRFIDRIQISPRGNGCPRKEIIVWKKNKSVVCVDPQAEWIQRIMEMLRKKSSSTPPVPVFKRKIP |
Endotoxin : | Less than 0.01 EU/μg of rRhCXCL-13 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles.12 months from date of receipt, -20 to -70 centigrade as supplied.1 month, 2 to 8 centigrade under sterile conditions after reconstitution.3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | CXCL13 |
Official Symbol | CXCL13 |
Gene ID | 574224 |
mRNA Refseq | NM_001032880.1 |
Protein Refseq | NP_001028052.1 |
UniProt ID | Q8HYN9 |
◆ Recombinant Proteins | ||
CXCL13-179C | Recombinant Cynomolgus Monkey CXCL13 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL13-50R | Recombinant Rat C-X-C motif chemokine ligand 13 Protein, His&SUMO tagged | +Inquiry |
CXCL13-5733H | Recombinant Human CXCL13 protein, hFc-tagged | +Inquiry |
CXCL13-4101M | Recombinant Mouse CXCL13 protein, His-tagged | +Inquiry |
Cxcl13-7161R | Recombinant Rat Cxcl13 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL13-7170HCL | Recombinant Human CXCL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL13 Products
Required fields are marked with *
My Review for All CXCL13 Products
Required fields are marked with *
0
Inquiry Basket