Recombinant Active Human BMP15 Protein, His-tagged(C-ter)

Cat.No. : BMP15-10H
Product Overview : Recombinant Active Human BMP15 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The transforming growth factor-beta superfamily includes large families of growth and differentiation factors. It is thought that this protein may be involved in oocyte maturation and follicular development as a homodimer or by forming heterodimers with a related protein, Gdf9. Defects in this gene are the cause of ovarian dysgenesis 2.[provided by RefSeq, Sep 2009]
Form : Powder
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 17 ng/mL.
AA Sequence : MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name BMP15 bone morphogenetic protein 15 [ Homo sapiens ]
Official Symbol BMP15
Synonyms BMP15; bone morphogenetic protein 15; GDF9B; BMP-15; GDF-9B; growth/differentiation factor 9B; ODG2; POF4;
Gene ID 9210
mRNA Refseq NM_005448
Protein Refseq NP_005439
MIM 300247
UniProt ID O95972

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP15 Products

Required fields are marked with *

My Review for All BMP15 Products

Required fields are marked with *

0
cart-icon
0
compare icon