Recombinant Active Human BMP5 Protein, His-tagged(C-ter)

Cat.No. : BMP5-15H
Product Overview : Recombinant Active Human BMP5 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is < 0.17 μg/mL.
AA Sequence : MAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : 20 mM Sodium citrate (pH 3.5) and 0.2 M NaCl.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name BMP5 bone morphogenetic protein 5 [ Homo sapiens ]
Official Symbol BMP5
Synonyms BMP5; bone morphogenetic protein 5; BMP-5; MGC34244;
Gene ID 653
mRNA Refseq NM_021073
Protein Refseq NP_066551
MIM 112265
UniProt ID P22003

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMP5 Products

Required fields are marked with *

My Review for All BMP5 Products

Required fields are marked with *

0
cart-icon