Recombinant Active Human FGF20 Protein, His-tagged(C-ter)
Cat.No. : | FGF20-80H |
Product Overview : | Recombinant Active Human FGF20 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor family. The fibroblast growth factors possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene product is a secreted neurotrophic factor but lacks a typical signal peptide. It is expressed in normal brain, particularly the cerebellum, and may regulate central nervous system development and function. Homodimerization of this protein was shown to regulate its receptor binding activity and concentration gradient in the extracellular matrix. Genetic variations of this gene have been associated with Parkinson disease susceptibility. [provided by RefSeq, Oct 2009] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-3.2 ng/mL. The specific activity of recombinant human FGF-20 is > 2 x 10^5 IU/mg. |
AA Sequence : | MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | FGF20 fibroblast growth factor 20 [ Homo sapiens ] |
Official Symbol | FGF20 |
Synonyms | FGF20; fibroblast growth factor 20; FGF-20; |
Gene ID | 26281 |
mRNA Refseq | NM_019851 |
Protein Refseq | NP_062825 |
MIM | 605558 |
UniProt ID | Q9NP95 |
◆ Recombinant Proteins | ||
FGF20-80H | Recombinant Active Human FGF20 Protein, His-tagged(C-ter) | +Inquiry |
FGF20-178H | Recombinant Human Fibroblast Growth Factor 20 | +Inquiry |
FGF20-1989R | Recombinant Rat FGF20 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF20-5848M | Recombinant Mouse FGF20 Protein | +Inquiry |
FGF20-116H | Active Recombinant Human FGF20 Protein (Pro3-Thr211), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF20-6243HCL | Recombinant Human FGF20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF20 Products
Required fields are marked with *
My Review for All FGF20 Products
Required fields are marked with *
0
Inquiry Basket