Recombinant Active Human IFNG Protein, His-tagged(C-ter)
Cat.No. : | IFNG-119H |
Product Overview : | Recombinant Active Human IFNG Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of the both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial inflections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Sep 2015] |
Form : | Powder |
Bio-activity : | Determined by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is < 1.1 ng/mL. |
AA Sequence : | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
Endotoxin : | Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 95% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI; |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
MIM | 147570 |
UniProt ID | P01579 |
◆ Recombinant Proteins | ||
IFNG-28244TH | Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-50H | Recombinant Human IFNG Protein | +Inquiry |
IFNG-579H | Recombinant Human IFNG protein, His-Avi-tagged | +Inquiry |
IFNG-1150H | Recombinant Human IFNG Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNG-5744C | Recombinant Cynomolgus monkey IFNG protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket