Recombinant Active Human IFNG Protein, His-tagged(C-ter)

Cat.No. : IFNG-119H
Product Overview : Recombinant Active Human IFNG Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of the both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial inflections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Sep 2015]
Form : Powder
Bio-activity : Determined by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is < 1.1 ng/mL.
AA Sequence : MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ
Endotoxin : Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IFNG interferon, gamma [ Homo sapiens ]
Official Symbol IFNG
Synonyms IFNG; interferon, gamma; interferon gamma; IFN-gamma; immune interferon; IFG; IFI;
Gene ID 3458
mRNA Refseq NM_000619
Protein Refseq NP_000610
MIM 147570
UniProt ID P01579

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNG Products

Required fields are marked with *

My Review for All IFNG Products

Required fields are marked with *

0
cart-icon
0
compare icon