| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Description : |
This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of the both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial inflections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Sep 2015] |
| Form : |
Powder |
| Bio-activity : |
Determined by its ability to induce cytotoxicity in HT29 cells. The ED50 for this effect is < 1.1 ng/mL. |
| AA Sequence : |
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFQGRRASQ |
| Endotoxin : |
Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test. |
| Purity : |
> 95% (by SDS-PAGE) |
| Applications : |
SDS-PAGE |
| Notes : |
For laboratory research only, not for drug, diagnostic or other use. |
| Storage : |
Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
| Storage Buffer : |
PBS (pH 8.0) |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |