Recombinant Horse IFNG protein
Cat.No. : | IFNG-440E |
Product Overview : | Recombinant Horse IFNG protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 143 |
Description : | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4, with 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by an anti-viral assay using human HeLa cells infected with encephalomyocarditis (EMC) virus is less than 10.0 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg. |
Molecular Mass : | Approximately 16.7 kDa, a single non-glycosylated polypeptide chain containing 143 amino acids. |
AA Sequence : | QAAFFKEIENLKEYFNASNPDVGDGGPLFLDILKNWKEDSDKKIIQSQIVSFYFKLFENLKDNQVIQKSMDTIKEDLFVKFFNSSTSKLEDFQKLIQIPVNDLKVQRKAISELIKVMNDLSPKANLRKRKRSQNPFRGRRALQ |
Endotoxin : | Less than 0.1 EU/µg of rEqIFN-γ as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IFNG |
Official Symbol | IFNG |
Synonyms | IFNG; interferon, gamma; interferon gamma; IFN-gamma; |
Gene ID | 100034181 |
mRNA Refseq | NM_001081949 |
Protein Refseq | NP_001075418 |
UniProt ID | P42160 |
◆ Recombinant Proteins | ||
IFNG-28244TH | Recombinant Human IFNG, His-tagged | +Inquiry |
IFNG-257H | Recombinant Human IFNG, StrepII-tagged | +Inquiry |
Ifng-118R | Recombinant Rat IFNG Protein, Fc-His-tagged(C-ter) | +Inquiry |
IFNG-264I | Active Recombinant Human IFNG Protein | +Inquiry |
IFNG-29196TH | Recombinant Human IFNG | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket