Recombinant Active Human IL24 Protein, His-tagged(C-ter)

Cat.No. : IL24-180H
Product Overview : Recombinant Active Human IL24 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to chemoattract BaF3 mouse pro-B cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is < 100 pg/ml.
AA Sequence : MQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQEN
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IL24 interleukin 24 [ Homo sapiens ]
Official Symbol IL24
Synonyms IL24; interleukin 24; ST16; interleukin-24; C49A; FISP; IL 4 induced secreted protein; IL 24; IL10B; mda 7; melanoma differentiation association protein 7; Mob 5; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; MDA7; MOB5;
Gene ID 11009
mRNA Refseq NM_001185156
Protein Refseq NP_001172085
MIM 604136
UniProt ID Q13007

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL24 Products

Required fields are marked with *

My Review for All IL24 Products

Required fields are marked with *

0
cart-icon
0
compare icon